Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRMS Rabbit Polyclonal Antibody (HRP)

SRMS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRM, PTK70, C20orf148, dJ697K14.1

UniProt

Q9H3Y6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PCMPQKAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_543013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cystatin A Antibody [mFluor Violet 500 SE]
NBP2-99327MFV500 0.1 mL

Rabbit Polyclonal Cystatin A Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Recombinant Rat ATP5B Protein, His (Fc)-Avi-tagged
ATP5B-524R 50 µg

Recombinant Rat ATP5B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PPAR Gamma Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1600176 100 µL

PPAR Gamma Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
AMHR2 (NM_020547) Human Over-expression Lysate
E45H17742-2 20 µg

AMHR2 (NM_020547) Human Over-expression Lysate

Sign In for Pricing
View Details
Dog Cluster of Differentiation 40 Ligand (CD40L) ELISA Kit
orb781181-01 48 Tests

Dog Cluster of Differentiation 40 Ligand (CD40L) ELISA Kit

Sign In for Pricing
View Details
Dog Cluster of Differentiation 40 Ligand (CD40L) ELISA Kit
orb781181-02 96 Tests

Dog Cluster of Differentiation 40 Ligand (CD40L) ELISA Kit

Sign In for Pricing
View Details