Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT2 Rabbit Polyclonal Antibody (FITC)

CCT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CCTB, 99D8.1, PRO1633, CCT-beta, HEL-S-100n, TCP-1-beta

UniProt

P78371

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of CCT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cullin 4a/CUL4A Antibody Picoband® (Dylight488 Conjugate)
A01579-1-Dylight488 100 µg

Anti-Cullin 4a/CUL4A Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Bcl-2 (PPP1R50, protein phosphatase 1, regulatory subunit 50, Oncogene B-Cell Leukemia 2)
144226 100 µg

Bcl-2 (PPP1R50, protein phosphatase 1, regulatory subunit 50, Oncogene B-Cell Leukemia 2)

Sign In for Pricing
View Details
Rat Soluble Interleukin 2beta Receptor ELISA Kit
MBS041555-01 48 Well

Rat Soluble Interleukin 2beta Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Soluble Interleukin 2beta Receptor ELISA Kit
MBS041555-02 96 Well

Rat Soluble Interleukin 2beta Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Soluble Interleukin 2beta Receptor ELISA Kit
MBS041555-03 5x 96 Well

Rat Soluble Interleukin 2beta Receptor ELISA Kit

Sign In for Pricing
View Details
Rat Soluble Interleukin 2beta Receptor ELISA Kit
MBS041555-04 10x 96 Well

Rat Soluble Interleukin 2beta Receptor ELISA Kit

Sign In for Pricing
View Details