Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT2 Rabbit Polyclonal Antibody (FITC)

CCT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CCTB, 99D8.1, PRO1633, CCT-beta, HEL-S-100n, TCP-1-beta

UniProt

P78371

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of CCT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF7IP Knockout NCI-H1975 Polyclonal Cells
ARG31272 1 Million

ATF7IP Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
MBS7242935-01 48 Well

Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit

Sign In for Pricing
View Details
Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
MBS7242935-02 96 Well

Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit

Sign In for Pricing
View Details
Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
MBS7242935-03 5x 96 Well

Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit

Sign In for Pricing
View Details
Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit
MBS7242935-04 10x 96 Well

Rabbit Acyl-coenzyme A thioesterase 12 (ACOT12) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Strc shRNA (UAS) - Lentiviral mouse Strc shRNA (UAS, RFP) plasmid
GTR15165625 1 Vial

Lentiviral mouse Strc shRNA (UAS) - Lentiviral mouse Strc shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details