Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT2 Rabbit Polyclonal Antibody (HRP)

CCT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCTB, 99D8.1, PRO1633, CCT-beta, HEL-S-100n, TCP-1-beta

UniProt

P78371

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of CCT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fam160b2 (NM_194345) AAV Particle
MR212769A1V 250 µL

Mouse Fam160b2 (NM_194345) AAV Particle

Sign In for Pricing
View Details
LNX1 (Ligand of Numb-protein X 1, LNX, MPDZ, PDZRN2) (MaxLight 650)
MBS6447567-01 0.1 mL

LNX1 (Ligand of Numb-protein X 1, LNX, MPDZ, PDZRN2) (MaxLight 650)

Sign In for Pricing
View Details
LNX1 (Ligand of Numb-protein X 1, LNX, MPDZ, PDZRN2) (MaxLight 650)
MBS6447567-02 5x 0.1 mL

LNX1 (Ligand of Numb-protein X 1, LNX, MPDZ, PDZRN2) (MaxLight 650)

Sign In for Pricing
View Details
Potassium Inwardly Rectifying Channel Subfamily J, Member 15 (KCNJ15) Antibody
abx241672-01 50 µL

Potassium Inwardly Rectifying Channel Subfamily J, Member 15 (KCNJ15) Antibody

Sign In for Pricing
View Details
Potassium Inwardly Rectifying Channel Subfamily J, Member 15 (KCNJ15) Antibody
abx241672-02 100 µL

Potassium Inwardly Rectifying Channel Subfamily J, Member 15 (KCNJ15) Antibody

Sign In for Pricing
View Details
(R) -Pyrrolidine-2-carboxamide 100g
A23046-100000 100000 mg

(R) -Pyrrolidine-2-carboxamide 100g

Sign In for Pricing
View Details