Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dgat1 Rabbit Polyclonal Antibody (HRP)

Dgat1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARAT, Dgat, C75990, D15Ertd23, D15Ertd23e

UniProt

Q9Z2A7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Dgat1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034176

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H) (MaxLight 750)
MBS6237715-01 0.1 mL

CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H) (MaxLight 750)

Sign In for Pricing
View Details
CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H) (MaxLight 750)
MBS6237715-02 5x 0.1 mL

CNOT2 (CCR4-NOT Transcription Complex, Subunit 2, CDC36, HSPC131, NOT2, NOT2H) (MaxLight 750)

Sign In for Pricing
View Details
Arhgap22-set siRNA/shRNA/RNAi Lentivector (Rat)
12288096 4x 500 ng

Arhgap22-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Human Laminin PicoKine ELISA Kit
MBS175954-01 96 Well

Human Laminin PicoKine ELISA Kit

Sign In for Pricing
View Details
Human Laminin PicoKine ELISA Kit
MBS175954-02 5x 96 Well

Human Laminin PicoKine ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal FoxP3 Antibody (1054C) [Janelia Fluor 525]
FAB8214JF525 0.1 mL

Rabbit Monoclonal FoxP3 Antibody (1054C) [Janelia Fluor 525]

Sign In for Pricing
View Details