Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL13RA1 Rabbit Polyclonal Antibody (FITC)

IL13RA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NR4, CT19, CD213A1, IL-13Ra

UniProt

P78552

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human I13R1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVE

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cr1l Mouse Monoclonal Antibody [Clone ID: 512]
AM31835PU-N 250 µg

Cr1l Mouse Monoclonal Antibody [Clone ID: 512]

Sign In for Pricing
View Details
Cytokeratin 15 (KRT15) Mouse Monoclonal Antibody [Clone ID: 6E7]
AM06387SU-N 100 µL

Cytokeratin 15 (KRT15) Mouse Monoclonal Antibody [Clone ID: 6E7]

Sign In for Pricing
View Details
Smpd1 Mouse Gene Knockout Kit (CRISPR)
KN516344 1 Kit

Smpd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Metastasis, unknown source
CS802781 5x 5 µm

Tissue FFPE Sections, Metastasis, unknown source

Sign In for Pricing
View Details
MASA (ENOPH1) (NM_021204) Human Recombinant Protein
TP309510 20 µg

MASA (ENOPH1) (NM_021204) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS508221 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details