Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1E Rabbit Polyclonal Antibody (Biotin)

CD1E Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R2, CD1A

UniProt

P15812

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD1E

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVCA2 antibody
FNab06046 100 µg

OVCA2 antibody

Sign In for Pricing
View Details
KCNH1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2424R-BF594-01 20 µL

KCNH1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
KCNH1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2424R-BF594-02 100 µL

KCNH1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
CD1a (O10), Biotin conjugate, 0.1mg/mL
BNCB0667-500 1x 500 µL

CD1a (O10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS512197 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
TRPM7 Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1811669 100 µL

TRPM7 Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details