Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1B Rabbit Polyclonal Antibody (Biotin)

CD1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R1, CD1, CD1A

UniProt

P29016

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001755

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P22 3'UTR Luciferase Stable Cell Line
TU020928 1.0 mL

RPL21P22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HAX1 (HCLS1-associated Protein X-1, SCN3, HS1-Binding Protein 1, HS1BP1, HCLSBP1) (Biotin)
MBS6419865-01 0.1 mL

HAX1 (HCLS1-associated Protein X-1, SCN3, HS1-Binding Protein 1, HS1BP1, HCLSBP1) (Biotin)

Sign In for Pricing
View Details
HAX1 (HCLS1-associated Protein X-1, SCN3, HS1-Binding Protein 1, HS1BP1, HCLSBP1) (Biotin)
MBS6419865-02 5x 0.1 mL

HAX1 (HCLS1-associated Protein X-1, SCN3, HS1-Binding Protein 1, HS1BP1, HCLSBP1) (Biotin)

Sign In for Pricing
View Details
Recombinant Triangle waterfern Cyanovirin-N homolog
orb1647803-01 20 µg

Recombinant Triangle waterfern Cyanovirin-N homolog

Sign In for Pricing
View Details
Recombinant Triangle waterfern Cyanovirin-N homolog
orb1647803-02 100 µg

Recombinant Triangle waterfern Cyanovirin-N homolog

Sign In for Pricing
View Details
Recombinant Triangle waterfern Cyanovirin-N homolog
orb1647803-03 1 mg

Recombinant Triangle waterfern Cyanovirin-N homolog

Sign In for Pricing
View Details