Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rap1a Rabbit Polyclonal Antibody (HRP)

Rap1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R, Krev, Rap1, G-22K, Krev-1, AI848598

UniProt

P62835

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rap1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_663516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1563667 Protein Vector (Rat) (pPM-C-His)
PV300753 500 ng

RGD1563667 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
AGXT2L2 Rabbit Polyclonal Antibody (BF647)
orb2379465 100 µL

AGXT2L2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
DMT-2′Fluoro-dU Phosphoramidite
T38958-01 1 mL - 10 mM (in DMSO)

DMT-2′Fluoro-dU Phosphoramidite

Sign In for Pricing
View Details
DMT-2′Fluoro-dU Phosphoramidite
T38958-02 50 mg

DMT-2′Fluoro-dU Phosphoramidite

Sign In for Pricing
View Details
Recombinant Bordetella avium Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018375-01 0.02 mg

Recombinant Bordetella avium Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Bordetella avium Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018375-02 0.1 mg

Recombinant Bordetella avium Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details