Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOCS2 Rabbit Polyclonal Antibody (FITC)

SOCS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CIS2, SSI2, Cish2, SSI-2, SOCS-2, STATI2

UniProt

O14508

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTP23 Over-expression Lysate Product
GWB-89BB10 0.1 mg

UTP23 Over-expression Lysate Product

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody
abx301190-01 20 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody
abx301190-02 50 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody
abx301190-03 100 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody
abx301190-04 200 µg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody

Sign In for Pricing
View Details
Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody
abx301190-05 1 mg

Growth Arrest And DNA Damage-Inducible Protein GADD45 Gamma (GADD45G) Antibody

Sign In for Pricing
View Details