Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRT Rabbit Polyclonal Antibody (FITC)

PTPRT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

R-PTP-T, RPTPrho, RPTP-rho

UniProt

O14522

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

160kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EPHX2 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134260 100 µL

Anti-EPHX2 (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details
Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit
MBS458685-01 48 Tests

Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit
MBS458685-02 96 Tests

Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit
MBS458685-03 5x 96 Tests

Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit
MBS458685-04 10x 96 Tests

Rat Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit

Sign In for Pricing
View Details
SAMM50 ORF Vector (Human) (pORF)
ORF009192 1.0 µg DNA

SAMM50 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details