Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VILL Rabbit Polyclonal Antibody (Biotin)

VILL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NGPKTSISEKARGLALTYSLRDRERGGGRAQIGVVDDEAKAPDLMQIMEA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbp-set siRNA/shRNA/RNAi Lentivector (Mouse)
46292094 4x 500 ng

Tbp-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
RPL21P107 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV778015 1.0 µg DNA

RPL21P107 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]
TA500579AM 100 µL

Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]

Sign In for Pricing
View Details
Rabbit anti-ARK3 Antibody
YLD0578-01 50 µL

Rabbit anti-ARK3 Antibody

Sign In for Pricing
View Details
Rabbit anti-ARK3 Antibody
YLD0578-02 100 µL

Rabbit anti-ARK3 Antibody

Sign In for Pricing
View Details
Lentiviral human LIPK sgRNA gene knockout kit - Lentiviral human LIPK sgRNA gene knockout kit (25)
GTR15389859 1 Vial

Lentiviral human LIPK sgRNA gene knockout kit - Lentiviral human LIPK sgRNA gene knockout kit (25)

Sign In for Pricing
View Details