Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VILL Rabbit Polyclonal Antibody (Biotin)

VILL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NGPKTSISEKARGLALTYSLRDRERGGGRAQIGVVDDEAKAPDLMQIMEA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Ethyl-2- (prop-2-en-1-yl) propane-1,3-diol
CBA60626-01 100 mg

2-Ethyl-2- (prop-2-en-1-yl) propane-1,3-diol

Sign In for Pricing
View Details
2-Ethyl-2- (prop-2-en-1-yl) propane-1,3-diol
CBA60626-02 1 g

2-Ethyl-2- (prop-2-en-1-yl) propane-1,3-diol

Sign In for Pricing
View Details
KIAA1324 3'UTR Luciferase Stable Cell Line
TU011698 1.0 mL

KIAA1324 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
D930005D10RIK Antibody - C-terminal region : FITC (ARP37588_T100-FITC)
ARP37588_T100-FITC 100 µL

D930005D10RIK Antibody - C-terminal region : FITC (ARP37588_T100-FITC)

Sign In for Pricing
View Details
DMTr-2'-O-Me-rA (Bz) -3'-PS2-Amidite
PA306-100 100 g

DMTr-2'-O-Me-rA (Bz) -3'-PS2-Amidite

Sign In for Pricing
View Details
Rabbit Anti-Canine HLA Class II Histocompatibility Antigen DR Alpha Chain (HLA-DRA) Polyclonal Antibody
VD3N449 1 Each

Rabbit Anti-Canine HLA Class II Histocompatibility Antigen DR Alpha Chain (HLA-DRA) Polyclonal Antibody

Sign In for Pricing
View Details