Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VILL Rabbit Polyclonal Antibody (HRP)

VILL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGPKTSISEKARGLALTYSLRDRERGGGRAQIGVVDDEAKAPDLMQIMEA

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSN Antibody
8C11090-AAT 50 µg

TSN Antibody

Sign In for Pricing
View Details
(E,Z)-2-Propyl-2-pentenoic Acid
TRC-P838300-10MG 10 mg

(E,Z)-2-Propyl-2-pentenoic Acid

Sign In for Pricing
View Details
IVD (NM_001159508) Human Over-expression Lysate
LC431346 20 µg

IVD (NM_001159508) Human Over-expression Lysate

Sign In for Pricing
View Details
Saa3 Mouse Gene Knockout Kit (CRISPR)
KN515255 1 Kit

Saa3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Periostin (POSTN) Human Gene Knockout Kit (CRISPR)
KN215156 1 Kit

Periostin (POSTN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCP3 Recombinant Rabbit Monoclonal Antibody [PSH02-24]
HA721804 100 µL

SCP3 Recombinant Rabbit Monoclonal Antibody [PSH02-24]

Sign In for Pricing
View Details