Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF2RB Rabbit Polyclonal Antibody (Biotin)

CSF2RB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CD131, IL3RB, IL5RB, SMDP5, CDw131, betaGMR

UniProt

P32927

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) (MaxLight 750)
MBS6404901-01 0.1 mL

14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) (MaxLight 750)

Sign In for Pricing
View Details
14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) (MaxLight 750)
MBS6404901-02 5x 0.1 mL

14-3-3, tau (14-3-3 Protein theta, YWHAQ, 1C5, HS1, 14-3-3) (MaxLight 750)

Sign In for Pricing
View Details
Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)
MBS2104080-01 5x 96 Tests

Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)
MBS2104080-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)
MBS2104080-03 10x 96 Tests

Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)
MBS2104080-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Abl Interactor 1 (ABI1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details