Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlg3 Rabbit Polyclonal Antibody (Biotin)

Dlg3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DLG, SAP, Dlgh, Dlgh3, SAP102, mKIAA1232

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Dlg3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001171251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC5A3 Antibody
orb1533837 50 µg

SLC5A3 Antibody

Sign In for Pricing
View Details
PFKM Antibody / Phosphofructokinase muscle type
FY13106 100 µg

PFKM Antibody / Phosphofructokinase muscle type

Sign In for Pricing
View Details
Human Cystatin C/CST3 ELISA Kit PicoKine®
EK0678 96 Well With Removable Strips

Human Cystatin C/CST3 ELISA Kit PicoKine®

Sign In for Pricing
View Details
MOK, CT (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (PE)
MBS6488457-01 0.2 mL

MOK, CT (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (PE)

Sign In for Pricing
View Details
MOK, CT (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (PE)
MBS6488457-02 5x 0.2 mL

MOK, CT (MAPK/MAK/MRK Overlapping Kinase, MOK Protein Kinase, Renal Tumor Antigen 1, RAGE1 RAGE-1, RAGE) (PE)

Sign In for Pricing
View Details
CTX-TNA2 Cell Line
RWT-997 1x 10^6

CTX-TNA2 Cell Line

Sign In for Pricing
View Details