Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlg3 Rabbit Polyclonal Antibody (FITC)

Dlg3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DLG, SAP, Dlgh, Dlgh3, SAP102, mKIAA1232

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Dlg3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001171251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit
MBS7202741-01 48 Well

Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit

Sign In for Pricing
View Details
Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit
MBS7202741-02 96 Well

Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit

Sign In for Pricing
View Details
Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit
MBS7202741-03 5x 96 Well

Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit

Sign In for Pricing
View Details
Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit
MBS7202741-04 10x 96 Well

Rat Anaphase-promoting complex subunit 2 (ANAPC2) ELISA Kit

Sign In for Pricing
View Details
Anti-CD101 Antibody , HRP Conjugate
A07106-1-HRP 100 µg/Vial

Anti-CD101 Antibody , HRP Conjugate

Sign In for Pricing
View Details
SYTL5 Rabbit Polyclonal Antibody
orb7045-01 50 μL

SYTL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details