What is the catalog number for Dlg3 Rabbit Polyclonal Antibody (FITC)?

The catalog number for Dlg3 Rabbit Polyclonal Antibody (FITC) is orb2093565.

What sizes are available for Dlg3 Rabbit Polyclonal Antibody (FITC)?

Dlg3 Rabbit Polyclonal Antibody (FITC) is available in the following size(s): 100 µL.

Is Dlg3 Rabbit Polyclonal Antibody (FITC) in stock?

Dlg3 Rabbit Polyclonal Antibody (FITC) is currently made to order / not held in immediate stock. Contact us for lead time.

Dlg3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DLG, SAP, Dlgh, Dlgh3, SAP102, mKIAA1232

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Dlg3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.