Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlg3 Rabbit Polyclonal Antibody (HRP)

Dlg3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DLG, SAP, Dlgh, Dlgh3, SAP102, mKIAA1232

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Dlg3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001171251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F2RL2 Antibody - N-terminal region
ARP60036_P050-25UL 25 µL

F2RL2 Antibody - N-terminal region

Sign In for Pricing
View Details
Anti-HBcAg Antibody
orb1675238 0.1 mL

Anti-HBcAg Antibody

Sign In for Pricing
View Details
TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2)
353309 100 µg

TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2)

Sign In for Pricing
View Details
Histone cluster 1 H2AB CRISPR Activation Plasmid (h2)
sc-411139-ACT-2 20 µg

Histone cluster 1 H2AB CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
NPHS2 Recombinant Protein (Mouse)
RP154718 100 µg

NPHS2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit anti-PDHB Antibody
MBS4507783-01 0.05 mL

Rabbit anti-PDHB Antibody

Sign In for Pricing
View Details