Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR10 Rabbit Polyclonal Antibody (HRP)

CCR10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPR2

UniProt

P46092

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCR

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_057686

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE6 Antibody - middle region
ARP59453_P050-25UL 25 µL

CPNE6 Antibody - middle region

Sign In for Pricing
View Details
Rat Monoclonal OX40/TNFRSF4 Antibody (443318) [PE/Atto594]
FAB3388PEATT594 0.1 mL

Rat Monoclonal OX40/TNFRSF4 Antibody (443318) [PE/Atto594]

Sign In for Pricing
View Details
Recombinant Human CLDN11 Protein, N-GST & C-His
orb3154210-01 50 µg

Recombinant Human CLDN11 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CLDN11 Protein, N-GST & C-His
orb3154210-02 100 µg

Recombinant Human CLDN11 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CLDN11 Protein, N-GST & C-His
orb3154210-03 1 mg

Recombinant Human CLDN11 Protein, N-GST & C-His

Sign In for Pricing
View Details
Rat Monoclonal ART2.2/Art2b Antibody (Nika102) [Janelia Fluor 646]
NB100-65853JF646 0.125 mL

Rat Monoclonal ART2.2/Art2b Antibody (Nika102) [Janelia Fluor 646]

Sign In for Pricing
View Details