Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM1 Rabbit Polyclonal Antibody (Biotin)

TREM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CD354, TREM-1

UniProt

Q9NP99

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILLA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_061113

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE2, NT (Angiotensin-converting Enzyme 2, ACE-related Carboxypeptidase, Angiotensin-converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, Processed Angiotensin-converting Enzyme 2, UNQ868/PRO1885) (Biotin)
MBS6463155-01 0.2 mL

ACE2, NT (Angiotensin-converting Enzyme 2, ACE-related Carboxypeptidase, Angiotensin-converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, Processed Angiotensin-converting Enzyme 2, UNQ868/PRO1885) (Biotin)

Sign In for Pricing
View Details
ACE2, NT (Angiotensin-converting Enzyme 2, ACE-related Carboxypeptidase, Angiotensin-converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, Processed Angiotensin-converting Enzyme 2, UNQ868/PRO1885) (Biotin)
MBS6463155-02 5x 0.2 mL

ACE2, NT (Angiotensin-converting Enzyme 2, ACE-related Carboxypeptidase, Angiotensin-converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, Processed Angiotensin-converting Enzyme 2, UNQ868/PRO1885) (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 232 (ZNF232) Antibody
abx323103-01 50 µg

Zinc Finger Protein 232 (ZNF232) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 232 (ZNF232) Antibody
abx323103-02 100 µg

Zinc Finger Protein 232 (ZNF232) Antibody

Sign In for Pricing
View Details
Pig apolipoprotein E (Apo-E) ELISA Kit
MBS9424719-01 96 Tests

Pig apolipoprotein E (Apo-E) ELISA Kit

Sign In for Pricing
View Details
Pig apolipoprotein E (Apo-E) ELISA Kit
MBS9424719-02 5x 96 Tests

Pig apolipoprotein E (Apo-E) ELISA Kit

Sign In for Pricing
View Details