Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM1 Rabbit Polyclonal Antibody (HRP)

TREM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD354, TREM-1

UniProt

Q9NP99

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILLA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_061113

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Purpose Incubator BIGP-6403
BIGP-6403 1 Unit

General Purpose Incubator BIGP-6403

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802T3-01 20 Tests

Elab Fluor® Violet 540 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802T3-02 100 Tests

Elab Fluor® Violet 540 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802T3-03 2x 100 Tests

Elab Fluor® Violet 540 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF640R conjugate, 0.1mg/mL
BNC401927-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Weighing Scale BBAL-415
BBAL-415 1 Unit

Weighing Scale BBAL-415

Sign In for Pricing
View Details