Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRR2A Rabbit Polyclonal Antibody (FITC)

SPRR2A Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P35326

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_005979

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL34 Antibody
orb1327029 100 µg

IL34 Antibody

Sign In for Pricing
View Details
Recombinant Mouse COMP Protein, N-His
orb3056623-01 50 µg

Recombinant Mouse COMP Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse COMP Protein, N-His
orb3056623-02 100 µg

Recombinant Mouse COMP Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse COMP Protein, N-His
orb3056623-03 1 mg

Recombinant Mouse COMP Protein, N-His

Sign In for Pricing
View Details
Argininosuccinate Lyase Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-12515R-BF750 100 µL

Argininosuccinate Lyase Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Lipoprotein, High Density (HDL) and Lipoprotein, Low Density (LDL) /Lipoprotein, Very Low Density (VLDL) BioAssayTM Kit, Colorimetric discontinued
299020 100 Tests

Lipoprotein, High Density (HDL) and Lipoprotein, Low Density (LDL) /Lipoprotein, Very Low Density (VLDL) BioAssayTM Kit, Colorimetric discontinued

Sign In for Pricing
View Details