Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL22 Rabbit Polyclonal Antibody (Biotin)

RPL22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EAP, L22, HBP15, HBP15/L22

UniProt

P35268

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSK Antibody
MBS7112884-01 0.05 mL

CSK Antibody

Sign In for Pricing
View Details
CSK Antibody
MBS7112884-02 0.1 mL

CSK Antibody

Sign In for Pricing
View Details
CSK Antibody
MBS7112884-03 5x 0.1 mL

CSK Antibody

Sign In for Pricing
View Details
Platelet Antibody PA-Ab) Human ELISA Kit
90256 96 Tests

Platelet Antibody PA-Ab) Human ELISA Kit

Sign In for Pricing
View Details
Mouse Mc2r Pre-designed siRNA Set B
SI108235B 1 Each

Mouse Mc2r Pre-designed siRNA Set B

Sign In for Pricing
View Details
TIAM2 (T-lymphoma Invasion and Metastasis-inducing Protein 2, TIAM-2, KIAA2016, SIF and TIAM1-like Exchange Factor, STEF) (FITC)
134437-FITC 100 µL

TIAM2 (T-lymphoma Invasion and Metastasis-inducing Protein 2, TIAM-2, KIAA2016, SIF and TIAM1-like Exchange Factor, STEF) (FITC)

Sign In for Pricing
View Details