Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL22 Rabbit Polyclonal Antibody (FITC)

RPL22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EAP, L22, HBP15, HBP15/L22

UniProt

P35268

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF640R conjugate, 0.1mg/mL
BNC401576-500 1x 500 µL

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MycoLight™ Bacterial Viability Assay Kit
22400-AAT 200 Tests

MycoLight™ Bacterial Viability Assay Kit

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF594 conjugate, 0.1mg/mL
BNC941527-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acrolein 2,4-Dinitrophenylhydrazone-13C6
TRC-A191223-1MG 1 mg

Acrolein 2,4-Dinitrophenylhydrazone-13C6

Sign In for Pricing
View Details
Rat ApoA1 (Apolipoprotein A1) CLIA Kit
E-CL-R0710-01 24 Tests

Rat ApoA1 (Apolipoprotein A1) CLIA Kit

Sign In for Pricing
View Details
Rat ApoA1 (Apolipoprotein A1) CLIA Kit
E-CL-R0710-02 48 Tests

Rat ApoA1 (Apolipoprotein A1) CLIA Kit

Sign In for Pricing
View Details