Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL22 Rabbit Polyclonal Antibody (FITC)

RPL22 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EAP, L22, HBP15, HBP15/L22

UniProt

P35268

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 540 Anti-human CD16 Antibody *3G8*
10161120-AAT 100 Tests

MFluor™ Violet 540 Anti-human CD16 Antibody *3G8*

Sign In for Pricing
View Details
Recombinant Human APE1/APE Protein
PKSH032090-01 10 µg

Recombinant Human APE1/APE Protein

Sign In for Pricing
View Details
Recombinant Human APE1/APE Protein
PKSH032090-02 50 µg

Recombinant Human APE1/APE Protein

Sign In for Pricing
View Details
Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein / GP (Virion spike glycoprotein) Protein (His Tag)
PKSV030150 100 µg

Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein / GP (Virion spike glycoprotein) Protein (His Tag)

Sign In for Pricing
View Details
4-Hydroxybenzenesulfonic Acid (85%)
TRC-H807805-50G 50 g

4-Hydroxybenzenesulfonic Acid (85%)

Sign In for Pricing
View Details
Tumor protein D52 like 3 (TPD52L3) (NM_001001874) Human Over-expression Lysate
LY424257 100 µg

Tumor protein D52 like 3 (TPD52L3) (NM_001001874) Human Over-expression Lysate

Sign In for Pricing
View Details