Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL22 Rabbit Polyclonal Antibody (HRP)

RPL22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EAP, L22, HBP15, HBP15/L22

UniProt

P35268

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Anisaldehyde Propylene Glycol Acetal-d3
TRC-A673212-2.5MG 2.5 mg

p-Anisaldehyde Propylene Glycol Acetal-d3

Sign In for Pricing
View Details
CRELD2 Human qPCR Primer Pair (NM_001135101)
HP231765 200 Reactions

CRELD2 Human qPCR Primer Pair (NM_001135101)

Sign In for Pricing
View Details
Normal Colon Fibroblasts
C05DON 1000000 Cells

Normal Colon Fibroblasts

Sign In for Pricing
View Details
GFR α-1 Antibody
8C0200-AAT 50 µg

GFR α-1 Antibody

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF594 conjugate, 0.1mg/mL
BNC940315-500 1x 500 µL

Heparan Sulphate Proteoglycan (A7L6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS713881 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details