Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdia3 Rabbit Polyclonal Antibody (HRP)

Pdia3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E, P, Erp, Grp, PDI, PDI-, Plca, 58kDa, ERp57, ERp60, ERp61, Grp58, PDI-Q2, PI-PLC, PLC[a]

UniProt

P27773

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-670-5p miRNA Mimic
CMH0869-01 5 nmol

Hsa-miR-670-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-670-5p miRNA Mimic
CMH0869-02 10 nmol

Hsa-miR-670-5p miRNA Mimic

Sign In for Pricing
View Details
MAPT Human Pre-designed siRNA Set A
HY-RS08140 1 Set

MAPT Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Caspase 4 (Caspase-4, CASP 4, CASP4, CASP-4, Apoptotic Cysteine Protease Mih1/TX, ICH 2, Ich-2, ICH2 Protease, Mih1/TX, TX, TX Protease) (MaxLight 550)
C2087-23V-ML550 100 µL

Caspase 4 (Caspase-4, CASP 4, CASP4, CASP-4, Apoptotic Cysteine Protease Mih1/TX, ICH 2, Ich-2, ICH2 Protease, Mih1/TX, TX, TX Protease) (MaxLight 550)

Sign In for Pricing
View Details
Mmu-miR-883b-3p miRNA Inhibitor
orb1870430-01 10 nmol

Mmu-miR-883b-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-883b-3p miRNA Inhibitor
orb1870430-02 20 nmol

Mmu-miR-883b-3p miRNA Inhibitor

Sign In for Pricing
View Details