Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdia3 Rabbit Polyclonal Antibody (HRP)

Pdia3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E, P, Erp, Grp, PDI, PDI-, Plca, 58kDa, ERp57, ERp60, ERp61, Grp58, PDI-Q2, PI-PLC, PLC[a]

UniProt

P27773

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031978

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human GMP reductase 2 polyclonal Antibody(GMPR2), Biotin conjugated
MBS1491989-01 0.05 mg

Rabbit anti-human GMP reductase 2 polyclonal Antibody(GMPR2), Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human GMP reductase 2 polyclonal Antibody(GMPR2), Biotin conjugated
MBS1491989-02 0.1 mg

Rabbit anti-human GMP reductase 2 polyclonal Antibody(GMPR2), Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human GMP reductase 2 polyclonal Antibody(GMPR2), Biotin conjugated
MBS1491989-03 5x 0.1 mg

Rabbit anti-human GMP reductase 2 polyclonal Antibody(GMPR2), Biotin conjugated

Sign In for Pricing
View Details
KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase), CD309, FLK1, VEGFR, VEGFR2) (MaxLight 550)
MBS6217708-01 0.1 mL

KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase), CD309, FLK1, VEGFR, VEGFR2) (MaxLight 550)

Sign In for Pricing
View Details
KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase), CD309, FLK1, VEGFR, VEGFR2) (MaxLight 550)
MBS6217708-02 5x 0.1 mL

KDR (Kinase Insert Domain Receptor (a Type III Receptor Tyrosine Kinase), CD309, FLK1, VEGFR, VEGFR2) (MaxLight 550)

Sign In for Pricing
View Details
Human EMMPRIN/CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit
MBS2506251-01 24 Tests

Human EMMPRIN/CD147 (Extracellular Matrix Metalloproteinase Inducer) ELISA Kit

Sign In for Pricing
View Details