Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL5RA Rabbit Polyclonal Antibody (FITC)

IL5RA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IL5R, CD125, CDw125, HSIL5R3

UniProt

Q01344

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILH

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_783853

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vasoactive Intestinal Peptide, VIP ELISA Kit
MBS700431-01 24 Well (LIMIT 1)

Human Vasoactive Intestinal Peptide, VIP ELISA Kit

Sign In for Pricing
View Details
Human Vasoactive Intestinal Peptide, VIP ELISA Kit
MBS700431-02 48 Well

Human Vasoactive Intestinal Peptide, VIP ELISA Kit

Sign In for Pricing
View Details
Human Vasoactive Intestinal Peptide, VIP ELISA Kit
MBS700431-03 96 Well

Human Vasoactive Intestinal Peptide, VIP ELISA Kit

Sign In for Pricing
View Details
Human Vasoactive Intestinal Peptide, VIP ELISA Kit
MBS700431-04 5x 96 Well

Human Vasoactive Intestinal Peptide, VIP ELISA Kit

Sign In for Pricing
View Details
Human Vasoactive Intestinal Peptide, VIP ELISA Kit
MBS700431-05 10x 96 Well

Human Vasoactive Intestinal Peptide, VIP ELISA Kit

Sign In for Pricing
View Details
MAPT Antibody
orb688957-01 50 μL

MAPT Antibody

Sign In for Pricing
View Details