Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD37 Rabbit Polyclonal Antibody (FITC)

CD37 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GP52-40, TSPAN26

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (PE) discontinued
039517-PE 200 µL

OSCAR, CT (OSCAR, Osteoclast-associated immunoglobulin-like receptor, Polymeric immunoglobulin receptor 3) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal KIF6 Antibody
NBP2-57091-25ul 25 µL

Rabbit Polyclonal KIF6 Antibody

Sign In for Pricing
View Details
Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]
CL007R 50 µg

Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]

Sign In for Pricing
View Details
Tmem130 (NM_177735) Mouse Tagged Lenti ORF Clone
MR206660L3 10 µg

Tmem130 (NM_177735) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Arl16 (NM_197995) Mouse Tagged ORF Clone Lentiviral Particle
MR212564L4V 200 µL

Arl16 (NM_197995) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CPN1 antibody - middle region (ARP51939_P050)
ARP51939_P050 100 µL

CPN1 antibody - middle region (ARP51939_P050)

Sign In for Pricing
View Details