Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD37 Rabbit Polyclonal Antibody (FITC)

CD37 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GP52-40, TSPAN26

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE10A Protein Lysate (Human) with C-Ha Tag
36274031 100 µg

PDE10A Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MIR4722 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV770110 1.0 µg DNA

MIR4722 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
FLT3 Peptide
MBS154045-01 0.05 mg

FLT3 Peptide

Sign In for Pricing
View Details
FLT3 Peptide
MBS154045-02 5x 0.05 mg

FLT3 Peptide

Sign In for Pricing
View Details
Human DNA-binding protein A (CSDA) ELISA Kit
RK12328 96 Tests

Human DNA-binding protein A (CSDA) ELISA Kit

Sign In for Pricing
View Details
HRH2 Human qPCR Primer Pair (NM_022304)
HP214417 200 Reactions

HRH2 Human qPCR Primer Pair (NM_022304)

Sign In for Pricing
View Details