Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNC Rabbit Polyclonal Antibody (HRP)

SYNC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SYNC1, SYNCOILIN

UniProt

Q9H7C4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEER

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001155180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING1 Mouse Monoclonal Antibody [Clone ID: OTI6F11]
CF809256 100 µg

RING1 Mouse Monoclonal Antibody [Clone ID: OTI6F11]

Sign In for Pricing
View Details
ANO1 Polyclonal Antibody
ANT-10213-100ug 100 µg

ANO1 Polyclonal Antibody

Sign In for Pricing
View Details
CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (PE)
MBS6372464-01 0.1 mL

CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (PE)

Sign In for Pricing
View Details
CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (PE)
MBS6372464-02 5x 0.1 mL

CC2D1A (AKI1, Coiled-coil and C2 Domain-containing Protein 1A, Akt Kinase-interacting Protein 1, Five Prime Repressor Element Under Dual Repression-binding Protein 1, Putative NF-kappa-B-activating Protein 023N, FLJ20241, FLJ41160) (PE)

Sign In for Pricing
View Details
IGFBP3 Rabbit Polyclonal Antibody (HRP)
orb2578606 100 µg

IGFBP3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ZNF117 Antibody Blocking peptide
orb1458091 500 µg

ZNF117 Antibody Blocking peptide

Sign In for Pricing
View Details