Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Rabbit Polyclonal Antibody (Biotin)

TCP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha

UniProt

P17987

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_110379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) - (-) -Eicosapentaenyl-2'-hydroxy-1'-propylamide
orb3144162-01 50 mg

(R) - (-) -Eicosapentaenyl-2'-hydroxy-1'-propylamide

Sign In for Pricing
View Details
(R) - (-) -Eicosapentaenyl-2'-hydroxy-1'-propylamide
orb3144162-02 10 mg

(R) - (-) -Eicosapentaenyl-2'-hydroxy-1'-propylamide

Sign In for Pricing
View Details
C14orf105 Antibody Blocking peptide
orb1459686 500 µg

C14orf105 Antibody Blocking peptide

Sign In for Pricing
View Details
CHD4 (ATP-dependent Helicase CHD4, Mi-2 Autoantigen 218kD Protein, Mi2-beta)
369333 100 µL

CHD4 (ATP-dependent Helicase CHD4, Mi-2 Autoantigen 218kD Protein, Mi2-beta)

Sign In for Pricing
View Details
MED9 (Mediator of RNA Polymerase II Transcription Subunit 9, Mediator Complex Subunit 9, MED9, MED25) discontinued
224092-01 50 µL

MED9 (Mediator of RNA Polymerase II Transcription Subunit 9, Mediator Complex Subunit 9, MED9, MED25) discontinued

Sign In for Pricing
View Details
MED9 (Mediator of RNA Polymerase II Transcription Subunit 9, Mediator Complex Subunit 9, MED9, MED25) discontinued
224092-02 100 µL

MED9 (Mediator of RNA Polymerase II Transcription Subunit 9, Mediator Complex Subunit 9, MED9, MED25) discontinued

Sign In for Pricing
View Details