Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13C Rabbit Polyclonal Antibody (Biotin)

TNFRSF13C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BAFFR, CD268, CVID4, BAFF-R, BROMIX, prolixin

UniProt

Q96RJ3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443177

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 Antibody (FITC)
orb434957 0.1 mg

CD16 Antibody (FITC)

Sign In for Pricing
View Details
Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) (MaxLight 550) discontinued
I8426-15B-ML550 100 µL

Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PLV3-U6-ELOVL1-shRNA3-CopGFP-Puro Plasmid
PVT71264 2 µg

PLV3-U6-ELOVL1-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Sphingomonas wittichii Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1008149-01 0.02 mg (E-Coli)

Recombinant Sphingomonas wittichii Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Sphingomonas wittichii Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1008149-02 0.1 mg (E-Coli)

Recombinant Sphingomonas wittichii Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Sphingomonas wittichii Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1008149-03 0.02 mg (Baculovirus)

Recombinant Sphingomonas wittichii Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details