Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13C Rabbit Polyclonal Antibody (FITC)

TNFRSF13C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BAFFR, CD268, CVID4, BAFF-R, BROMIX, prolixin

UniProt

Q96RJ3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443177

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mLH1 Human Gene Knockout Kit (CRISPR)
KN201607 1 Kit

mLH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vdac1 Mouse Gene Knockout Kit (CRISPR)
KN518873 1 Kit

Vdac1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin Conjugated Helix aspersa Lectin (Garden Snail) -HAA-
I-3801-1 1 mg

Ferritin Conjugated Helix aspersa Lectin (Garden Snail) -HAA-

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF740 conjugate, 0.1mg/mL
BNC740373-100 1x 100 µL

Human IgM Immunoglobulin (IM373), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLPX Recombinant Rabbit Monoclonal Antibody [JE62-96]
HA721016 100 µL

CLPX Recombinant Rabbit Monoclonal Antibody [JE62-96]

Sign In for Pricing
View Details
ILF3 (NM_012218) Human Recombinant Protein
TP314999M 100 µg

ILF3 (NM_012218) Human Recombinant Protein

Sign In for Pricing
View Details