Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13C Rabbit Polyclonal Antibody (FITC)

TNFRSF13C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BAFFR, CD268, CVID4, BAFF-R, BROMIX, prolixin

UniProt

Q96RJ3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443177

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

epsilon TubuLin (TUBE1) (NM_016262) Human Recombinant Protein
TP306165 20 µg

epsilon TubuLin (TUBE1) (NM_016262) Human Recombinant Protein

Sign In for Pricing
View Details
Didesulfo Cyanine 3 Monofunctional Hexanoic Acid Dye
TRC-D257470-25MG 25 mg

Didesulfo Cyanine 3 Monofunctional Hexanoic Acid Dye

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS705576 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
BMPER Rabbit Polyclonal Antibody
TA372111 100 µL

BMPER Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADRM1 (NM_175573) Human Recombinant Protein
TP305671L 1 mg

ADRM1 (NM_175573) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB525797 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details