Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13C Rabbit Polyclonal Antibody (HRP)

TNFRSF13C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BAFFR, CD268, CVID4, BAFF-R, BROMIX, prolixin

UniProt

Q96RJ3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443177

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ferritin, Heavy Polypeptide (FTH) ELISA Kit
RD-FTH-Ra-01 96 Tests

Rat Ferritin, Heavy Polypeptide (FTH) ELISA Kit

Sign In for Pricing
View Details
Rat Ferritin, Heavy Polypeptide (FTH) ELISA Kit
RD-FTH-Ra-02 48 Tests

Rat Ferritin, Heavy Polypeptide (FTH) ELISA Kit

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-2602
BCLT-2602 1 Unit

Low Temperature Circulator BCLT-2602

Sign In for Pricing
View Details
Human N4BP2L2 activation kit by CRISPRa
GA107121 1 Kit

Human N4BP2L2 activation kit by CRISPRa

Sign In for Pricing
View Details
SIVA (SIVA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA506835BM 100 µL

SIVA (SIVA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD Protein, His Tag (BA.2.76/Omicron) (MALS verified)
SPD-C522v-100ug 100 µg

SARS-CoV-2 Spike RBD Protein, His Tag (BA.2.76/Omicron) (MALS verified)

Sign In for Pricing
View Details