SAA2 Rabbit Polyclonal Antibody (Biotin)
SAA2 Rabbit Polyclonal Antibody (Biotin)
Product Specifications
Product Name Alternative
SAA, SAA1
Clonality
Polyclonal
Conjugation
Biotin
Sequence
Synthetic peptide located within the following region: GAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGL
Purification
Affinity Purified
Form
Liquid. Purified antibody supplied in 1x PBS buffer.
Molecular Weight
13kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Tested Applications
WB
NCBI Accession Number
NP_110381
Host or Source
Rabbit
Preservative
Liquid. Purified antibody supplied in 1x PBS buffer.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M2360-05-HRP 100 µL
MAP Kinase p44/42, CT (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, Mapk, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, MNK1, p44-ERK1, ERK1, PRKM3) (HRP) discontinued
Sign In for Pricing
View Details 
031271-ML550 100 µL
SWAP70 (SWAP70, KIAA0640, Switch-associated protein 70) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
MBS1040593-01 0.02 mg (E-Coli)
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Tryptophan biosynthesis protein TrpCF (trpC)
Sign In for Pricing
View Details MBS1040593-02 0.02 mg (Yeast)
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Tryptophan biosynthesis protein TrpCF (trpC)
Sign In for Pricing
View Details MBS1040593-03 0.1 mg (E-Coli)
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Tryptophan biosynthesis protein TrpCF (trpC)
Sign In for Pricing
View Details MBS1040593-04 0.1 mg (Yeast)
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Tryptophan biosynthesis protein TrpCF (trpC)
Sign In for Pricing
View Details