Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAA2 Rabbit Polyclonal Antibody (HRP)

SAA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAA, SAA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_110381

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX13, CT (SNX13, KIAA0713, Sorting nexin-13, RGS domain- and PHOX domain-containing protein, RGS-PX1) (MaxLight 490) discontinued
042109-ML490 100 µL

SNX13, CT (SNX13, KIAA0713, Sorting nexin-13, RGS domain- and PHOX domain-containing protein, RGS-PX1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
LCD Digital Thermo Mix With Heating And Mixing With 1.5 mL Heating Block (E11346) - ABDOS
E11342 1 Unit/Pack

LCD Digital Thermo Mix With Heating And Mixing With 1.5 mL Heating Block (E11346) - ABDOS

Sign In for Pricing
View Details
SH3BGR Protein Vector (Rat) (pPB-N-His)
PV304711 500 ng

SH3BGR Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis Thymidylate kinase (tmk)
MBS1065629-01 0.02 mg (E-Coli)

Recombinant Bacillus thuringiensis Thymidylate kinase (tmk)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis Thymidylate kinase (tmk)
MBS1065629-02 0.1 mg (E-Coli)

Recombinant Bacillus thuringiensis Thymidylate kinase (tmk)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis Thymidylate kinase (tmk)
MBS1065629-03 0.02 mg (Yeast)

Recombinant Bacillus thuringiensis Thymidylate kinase (tmk)

Sign In for Pricing
View Details