Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRTN Rabbit Polyclonal Antibody (HRP)

NRTN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NTN

UniProt

Q99748

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CILP, Control Peptide (Cartilage Intermediate Layer Protein 1, CILP-1, Cartilage Intermediate-layer Protein, UNQ602/PRO1188)
147774 100 µg

CILP, Control Peptide (Cartilage Intermediate Layer Protein 1, CILP-1, Cartilage Intermediate-layer Protein, UNQ602/PRO1188)

Sign In for Pricing
View Details
Usp15 Rat Pre-designed siRNA Set A
HY-RS23507 1 Set

Usp15 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit
MBS7616482-01 48 Well

Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit

Sign In for Pricing
View Details
Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit
MBS7616482-02 96 Well

Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit

Sign In for Pricing
View Details
Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit
MBS7616482-03 5x 96 Well

Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit

Sign In for Pricing
View Details
Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit
MBS7616482-04 10x 96 Well

Canine anti-KLH IgG (anti-Keyhole Limpet Hemocyanin IgG) ELISA Kit

Sign In for Pricing
View Details