Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGM2 Rabbit Polyclonal Antibody (HRP)

PGM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSTP006

UniProt

Q96G03

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060760

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primary Neural Stem Cell Medium
AFG-ELL-2433-01 100 mL

Primary Neural Stem Cell Medium

Sign In for Pricing
View Details
Primary Neural Stem Cell Medium
AFG-ELL-2433-02 500 mL

Primary Neural Stem Cell Medium

Sign In for Pricing
View Details
EFNA4 Antibody
E30AC3220 100 µL

EFNA4 Antibody

Sign In for Pricing
View Details
HIPK2 Rabbit Polyclonal Antibody (APC)
orb993152 100 µL

HIPK2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse Cyp2j6 qPCR Primer Pair
QM11838S 200 Tests

Mouse Cyp2j6 qPCR Primer Pair

Sign In for Pricing
View Details
TAF12 (TAF12 RNA Polymerase II, TATA Box Binding Protein (TBP) -Associated Factor, 20kD, Transcription Initiation Factor TFIID Subunit 12)
493319 100 µL

TAF12 (TAF12 RNA Polymerase II, TATA Box Binding Protein (TBP) -Associated Factor, 20kD, Transcription Initiation Factor TFIID Subunit 12)

Sign In for Pricing
View Details