Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPCS Rabbit Polyclonal Antibody (Biotin)

PPCS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CMD2C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_078940

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD33 (gp67, My9, Myeloid cell surface antigen CD33, p67, Sialic acid-binding Ig-like lectin 3 (Siglec 3) ) (BSA & Azide Free) (MaxLight 405) discontinued
168691-AF-ML405 100 µL

CD33 (gp67, My9, Myeloid cell surface antigen CD33, p67, Sialic acid-binding Ig-like lectin 3 (Siglec 3) ) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ITGB3 Mouse mAb
orb3184566-01 50 µL

ITGB3 Mouse mAb

Sign In for Pricing
View Details
ITGB3 Mouse mAb
orb3184566-02 100 µL

ITGB3 Mouse mAb

Sign In for Pricing
View Details
ITGB3 Mouse mAb
orb3184566-03 200 µL

ITGB3 Mouse mAb

Sign In for Pricing
View Details
Lentiviral mouse Gorasp1 shRNA (UAS) - Lentiviral mouseGorasp1 shRNA (UAS, GFP) (25)
GTR15113612 1 Vial

Lentiviral mouse Gorasp1 shRNA (UAS) - Lentiviral mouseGorasp1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
HLA Class I discontinued
537438-01 30ul

HLA Class I discontinued

Sign In for Pricing
View Details