Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A10 Rabbit Polyclonal Antibody (HRP)

S100A10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

42C, P11, p10, GP11, ANX2L, CAL1L, CLP11, Ca[1], ANX2LG

UniProt

P60903

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEF8 3'UTR GFP Stable Cell Line
TU055744 1.0 mL

DEF8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-Hypoxanthine Phosphoribosyltransferase 1 (HPRT1) Polyclonal Antibody
TRV-0020178-01 50 Tests

Anti-Hypoxanthine Phosphoribosyltransferase 1 (HPRT1) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Hypoxanthine Phosphoribosyltransferase 1 (HPRT1) Polyclonal Antibody
TRV-0020178-02 100 Tests

Anti-Hypoxanthine Phosphoribosyltransferase 1 (HPRT1) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Hypoxanthine Phosphoribosyltransferase 1 (HPRT1) Polyclonal Antibody
TRV-0020178-03 200 Tests

Anti-Hypoxanthine Phosphoribosyltransferase 1 (HPRT1) Polyclonal Antibody

Sign In for Pricing
View Details
KIN17 Rabbit pAb, AP conjugated
orb2863459 100 µL

KIN17 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
SMOX Protein Vector (Mouse) (pPB-C-His)
PV232018 500 ng

SMOX Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details