Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC1 Rabbit Polyclonal Antibody (FITC)

RAC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MIG5, MRD48, Rac-1, TC-25, p21-Rac1

UniProt

P63000

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Bach1 shRNA (UAS) - Lentiviral mouse Bach1 shRNA (UAS) (100)
GTR15140070 1 Vial

Lentiviral mouse Bach1 shRNA (UAS) - Lentiviral mouse Bach1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Cytokeratin 18 (Cytokeratin-18, CK 18, CK18, CK-18, CYK18, Cytokeratin endo B, Cell Proliferation-inducing Gene 46 Protein, K18, Keratin 18, Keratin-18, Keratin Type I Cytoskeletal 18, KRT18, Keratin D, Kerd, PIG46) (MaxLight 650)
137912-ML650 100 µL

Cytokeratin 18 (Cytokeratin-18, CK 18, CK18, CK-18, CYK18, Cytokeratin endo B, Cell Proliferation-inducing Gene 46 Protein, K18, Keratin 18, Keratin-18, Keratin Type I Cytoskeletal 18, KRT18, Keratin D, Kerd, PIG46) (MaxLight 650)

Sign In for Pricing
View Details
LY2794193 25mg
A19131-25 25 mg

LY2794193 25mg

Sign In for Pricing
View Details
HYR1 Antibody
orb847220-01 50 μL

HYR1 Antibody

Sign In for Pricing
View Details
HYR1 Antibody
orb847220-02 100 µL

HYR1 Antibody

Sign In for Pricing
View Details
Bovine Selenoprotein P (SEPP1) ELISA kit
CSB-EL021018BO-01 48 Tests

Bovine Selenoprotein P (SEPP1) ELISA kit

Sign In for Pricing
View Details