Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC1 Rabbit Polyclonal Antibody (HRP)

RAC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIG5, MRD48, Rac-1, TC-25, p21-Rac1

UniProt

P63000

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS26, NT (RPS26, 40S ribosomal protein S26) (Biotin) discontinued
041244-Biotin 200 µL

RPS26, NT (RPS26, 40S ribosomal protein S26) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Mycobacterium phage D29 Gene 52 protein (52)
MBS1214545-01 0.02 mg (E-Coli)

Recombinant Mycobacterium phage D29 Gene 52 protein (52)

Sign In for Pricing
View Details
Recombinant Mycobacterium phage D29 Gene 52 protein (52)
MBS1214545-02 0.1 mg (E-Coli)

Recombinant Mycobacterium phage D29 Gene 52 protein (52)

Sign In for Pricing
View Details
Recombinant Mycobacterium phage D29 Gene 52 protein (52)
MBS1214545-03 0.02 mg (Yeast)

Recombinant Mycobacterium phage D29 Gene 52 protein (52)

Sign In for Pricing
View Details
Recombinant Mycobacterium phage D29 Gene 52 protein (52)
MBS1214545-04 0.1 mg (Yeast)

Recombinant Mycobacterium phage D29 Gene 52 protein (52)

Sign In for Pricing
View Details
Recombinant Mycobacterium phage D29 Gene 52 protein (52)
MBS1214545-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium phage D29 Gene 52 protein (52)

Sign In for Pricing
View Details