Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP3 Rabbit Polyclonal Antibody (HRP)

BMP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BMP-3A

UniProt

P12645

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKSKNKKKQRKGPHRKSQTLQFDEQTLKKARRKQWIEPRNCARRYLKVDF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp263 shRNA (UAS) - Lentiviral mouse Zfp263 shRNA (UAS) plasmid
GTR15238183 1 Vial

Lentiviral mouse Zfp263 shRNA (UAS) - Lentiviral mouse Zfp263 shRNA (UAS) plasmid

Sign In for Pricing
View Details
AChRα1 (153) FITC
sc-65829 FITC 200 µg/mL

AChRα1 (153) FITC

Sign In for Pricing
View Details
Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit
MBS2905663-01 48 Well

Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit
MBS2905663-02 96 Well

Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit
MBS2905663-03 5x 96 Well

Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit
MBS2905663-04 10x 96 Well

Mouse Aifm3 / Apoptosis-inducing factor 3 ELISA Kit

Sign In for Pricing
View Details