Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4F2 Rabbit Polyclonal Antibody (Biotin)

CYP4F2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CPF2

UniProt

P78329

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001073

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tube1 Pre-designed siRNA Set B
SI115480B 1 Each

Mouse Tube1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PRF-1, ID (Zinc Finger Protein 395, ZNF395, Papillomavirus-binding Factor, Papillomavirus Regulatory Factor 1, HDBP2, Huntington Disease Gene Regulatory Region-binding Protein 2, HDBP-2, HD Gene Regulatory Region-binding Protein 2, HD-Regulating Factor 2, HDRF-2, PBF) (PE) discontinued
P3105-55C-PE 200 µL

PRF-1, ID (Zinc Finger Protein 395, ZNF395, Papillomavirus-binding Factor, Papillomavirus Regulatory Factor 1, HDBP2, Huntington Disease Gene Regulatory Region-binding Protein 2, HDBP-2, HD Gene Regulatory Region-binding Protein 2, HD-Regulating Factor 2, HDRF-2, PBF) (PE) discontinued

Sign In for Pricing
View Details
Human ABCA12 knockout cell line
ABC-KH0030 1 Vial

Human ABCA12 knockout cell line

Sign In for Pricing
View Details
PCMV-Prkn (mouse) -Myc-Neo
BZ53898 1 Vial

PCMV-Prkn (mouse) -Myc-Neo

Sign In for Pricing
View Details
1.5 ml Screw Cap Tube
B91106 500 Tubes/Bag

1.5 ml Screw Cap Tube

Sign In for Pricing
View Details
MCEMP1 hFc Chimera, Mouse
Z06262-100 100 µg

MCEMP1 hFc Chimera, Mouse

Sign In for Pricing
View Details