Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3RA Rabbit Polyclonal Antibody (HRP)

IL3RA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra

UniProt

P26951

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IL3RA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAX1 Polyclonal Antibody, HRP Conjugated
bs-11496R-HRP 100 µL

VAX1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Prepro-INSL4 C-Peptide (64-110) (Human) - Purified IgG Antibody
G-035-56 100 µg

Prepro-INSL4 C-Peptide (64-110) (Human) - Purified IgG Antibody

Sign In for Pricing
View Details
Lentiviral human SLC25A5 sgRNA gene knockout kit - Lentiviral human SLC25A5 sgRNA gene knockout kit (plasmid)
GTR15383033 1 Vial

Lentiviral human SLC25A5 sgRNA gene knockout kit - Lentiviral human SLC25A5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Vmn2r120 (NM_001104591) Mouse Tagged ORF Clone Lentiviral Particle
MR214528L4V 200 µL

Vmn2r120 (NM_001104591) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cdc23/APC8 Rabbit mAb
E60M1941 100 µL

Cdc23/APC8 Rabbit mAb

Sign In for Pricing
View Details
T-Lymphocyte Activation Antigen CD86 / B7-2 (CD86) Antibody (PerCP / Cyanine 5.5)
abx228188-01 20 Tests

T-Lymphocyte Activation Antigen CD86 / B7-2 (CD86) Antibody (PerCP / Cyanine 5.5)

Sign In for Pricing
View Details