Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3RA Rabbit Polyclonal Antibody (HRP)

IL3RA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra

UniProt

P26951

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IL3RA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas Aeruginosa lysS Protein (aa 1-501) (strain PA7)
VAng-Cr0542-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa lysS Protein (aa 1-501) (strain PA7)

Sign In for Pricing
View Details
OR2B11 3'UTR GFP Stable Cell Line
TU066364 1.0 mL

OR2B11 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti-GNT2A/GCNT2 Polyclonal Antibody
PAV7617 100 μL

Rabbit Anti-GNT2A/GCNT2 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human COX10 shRNA (UAS) - Lentiviral human COX10 shRNA (UAS, GFP) plasmid
GTR15119422 1 Vial

Lentiviral human COX10 shRNA (UAS) - Lentiviral human COX10 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Wwtr1 3'UTR Lenti-reporter-Luc Vector
50490086 1.0 µg

Wwtr1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
NEFM-Specific antibody
FNab05712 100 µg

NEFM-Specific antibody

Sign In for Pricing
View Details